PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00482.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 568aa    MW: 63644.4 Da    PI: 4.299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00482.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.33.1e-53101371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk
  Rsa1.0_00482.1_g00014.1  10 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWK 94 
                              579**************************9.99**************95347777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd+e+ + ++++vg+kktLv+++grap+ge+t+Wvmheyrl
  Rsa1.0_00482.1_g00014.1  95 TTGKDREIRN-GSRAVGMKKTLVYHRGRAPRGERTNWVMHEYRL 137
                              *********9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-618160IPR003441NAC domain
PROSITE profilePS5100557.83810160IPR003441NAC domain
PfamPF023655.5E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MGRGSVTTSL APGFRFHPTD EELVRYYLKR KVCNKPFKFD AISVTDIYKS EPWDLPDKSK  60
LKSRDLEWYF FSMLDKKYSN GSKTNRATEK GYWKTTGKDR EIRNGSRAVG MKKTLVYHRG  120
RAPRGERTNW VMHEYRLTDE ELKLANVPQD ACVLCRIFQK SGTGPKNGEQ YGAPYLEEEW  180
EEDKMTFVPE QDALSEGLAV DDDDVYVDIE DIDEKPENLV VYDAIPVQTN YCHGESSNNV  240
ESGNYEDSGN NVQPGNYVVD SSGYIELPME TFEEDKKPII RDCSIQPCSL FPDKQIGCGV  300
QDEHAENLET SNNNVFVAEA DSGYSDIPIE ADYLPDEQFM DPSNNLPLCD DLYLETKDLS  360
GGLQDDFNFE DYLNFFDDED AQNLTLDVSH LLGSGDALPN QEGLDQNPEE LEREVAEGKE  420
AVEKKESGEG SSSKQDADVT DFDSDSKYPF LKKSSHMFGV PPAFASQFQT KDAAIRLHAA  480
QSSGSVHVTA GMIRISNTTP AADSSDMGWA YDKNGNLDVV LSFGLVQRDD TMSKTGGTRA  540
TRAMLIFLCL WVLLLSVSFK IGTMVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-45916616171NO APICAL MERISTEM PROTEIN
1ut4_B3e-45916616171NO APICAL MERISTEM PROTEIN
1ut7_A3e-45916616171NO APICAL MERISTEM PROTEIN
1ut7_B3e-45916616171NO APICAL MERISTEM PROTEIN
3swm_A4e-45916619174NAC domain-containing protein 19
3swm_B4e-45916619174NAC domain-containing protein 19
3swm_C4e-45916619174NAC domain-containing protein 19
3swm_D4e-45916619174NAC domain-containing protein 19
3swp_A4e-45916619174NAC domain-containing protein 19
3swp_B4e-45916619174NAC domain-containing protein 19
3swp_C4e-45916619174NAC domain-containing protein 19
3swp_D4e-45916619174NAC domain-containing protein 19
4dul_A3e-45916616171NAC domain-containing protein 19
4dul_B3e-45916616171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122601.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A078C0E70.0A0A078C0E7_BRANA; BnaA10g25760D protein
STRINGBra009456.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2